Churchward Montezuma
Font Family by BluHead Studio
Includes 4 Font Styles from $60
Buy NowChurchward Montezuma is an unusual serif design by the late Joseph Churchward. The cut-in motif gives this four weight serif family a unique look mostly suitable for display work, but the lighter weights hold up well in text. Each weight has an alternate single story lowercase "a", and they all support the Western European character set.
Tags
aztecblackboldchurchwarddisplayeffectslightmediummexicoserifslab seriftextwacky
Test Drive
Font Style
Font Size – 60px
Type Your Text Here
4 Fonts Included
Churchward Montezuma Light | View All 248 Glyphs
Churchward Montezuma Light
from $20
Churchward Montezuma Medium | View All 248 Glyphs
Churchward Montezuma Medium
from $20
Churchward Montezuma Black | View All 255 Glyphs
Churchward Montezuma Black
from $20
Save 25% ($20) when you buy the full family!
Find More Fonts Like This: Fun/Wacky Fonts, Modern/Contemporary Fonts, Serif Fonts, and Special Effect Fonts
More Fonts From BluHead Studio
Churchward Ta Tiki | 1 Font | From $20
HeartBeats | 1 Font | From $15
Krete | 2 Fonts | From $40 $30
