Churchward Montezuma Poster Gallery Churchward Montezuma Thumbnail #1 Churchward Montezuma Thumbnail #2 Churchward Montezuma Thumbnail #3 Churchward Montezuma Thumbnail #4 Churchward Montezuma Thumbnail #5

Churchward Montezuma

Font Family by BluHead Studio

Includes 4 Font Styles from $60

Buy Now

Churchward Montezuma is an unusual serif design by the late Joseph Churchward. The cut-in motif gives this four weight serif family a unique look mostly suitable for display work, but the lighter weights hold up well in text. Each weight has an alternate single story lowercase "a", and they all support the Western European character set.
 

Tags
aztecblackboldchurchwarddisplayeffectslightmediummexicoserifslab seriftextwacky

Test Drive

Font Style

Font Size60px

Type Your Text Here

4 Fonts Included

Churchward Montezuma Light  |  View All 248 Glyphs

Churchward Montezuma Light

from $20

Churchward Montezuma Medium  |  View All 248 Glyphs

Churchward Montezuma Medium

from $20

Churchward Montezuma Bold  |  View All 248 Glyphs

Churchward Montezuma Bold

from $20

Churchward Montezuma Black  |  View All 255 Glyphs

Churchward Montezuma Black

from $20

Save 25% ($20) when you buy the full family!

Find More Fonts Like This: Fun/Wacky Fonts, Modern/Contemporary Fonts, Serif Fonts, and Special Effect Fonts

More Fonts From BluHead Studio

Churchward 69 Family  |  10 Fonts  |  From $180

Churchward 69 Family Font Poster

Churchward Design  |  9 Fonts  |  From $175

Churchward Design Font Poster

Churchward Roundsquare  |  5 Fonts  |  From $65

Churchward Roundsquare Font Poster

Sign Up for Our Newsletter

Sign Up

Churchward Montezuma

Font Family by BluHead Studio

4 Font Styles from $60

4 Font Styles from $60

Buy Now